(data stored in ACNUC1104 zone)

EMBL: AP008957.PE37

AP008957.PE37        Location/Qualifiers
FT   CDS             complement(43327..44199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30745"
FT                   /db_xref="GOA:C0ZLH7"
FT                   /db_xref="InterPro:IPR032290"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLH7"
FT                   /protein_id="BAH30745.1"
FT                   /translation="MIIFRQHQPRWSGAIRSQPTVRLDSPPLGTGFPQHPYRRTGRDMT
FT                   GKETQYEVTEIKAIRGTEAKTITNKQQEGWELIAQQQGHLRTTITFRRPKPKIPWRLWA
FT                   ALGAAVVIVLAGIITIGALQEDDSDASTTEAVAASSTEQSSPQPAPEPAAEPANRETAE
FT                   ILTIDNNEDLSRILRDTDNCGQSVADFATQYAGRTIQFDGHIAAMNNFNNKTRYDILIG
FT                   ARDFDEGDAGGPAFQFRDVNIVSDLQLTGPENSDTLGVKDTLRVTAVVEEFEKKTCLLQ
FT                   LEPISTEIR"
     MIIFRQHQPR WSGAIRSQPT VRLDSPPLGT GFPQHPYRRT GRDMTGKETQ YEVTEIKAIR        60
     GTEAKTITNK QQEGWELIAQ QQGHLRTTIT FRRPKPKIPW RLWAALGAAV VIVLAGIITI       120
     GALQEDDSDA STTEAVAASS TEQSSPQPAP EPAAEPANRE TAEILTIDNN EDLSRILRDT       180
     DNCGQSVADF ATQYAGRTIQ FDGHIAAMNN FNNKTRYDIL IGARDFDEGD AGGPAFQFRD       240
     VNIVSDLQLT GPENSDTLGV KDTLRVTAVV EEFEKKTCLL QLEPISTEIR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page