(data stored in ACNUC1104 zone)

EMBL: AP008957.PE370

AP008957.PE370       Location/Qualifiers
FT   CDS             409136..410188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31078"
FT                   /db_xref="GOA:C0ZN26"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN26"
FT                   /protein_id="BAH31078.1"
FT                   /translation="MHFHDDSLFPETQDKLVITVAPYGPEWEPDDFAEDLPLSMDEHVQ
FT                   QAVDCFNAGATVLHIHVRELDGKGSKRLSKFNELLGRLREAVPEMILQVGGSISFAPEG
FT                   EGADAKWLSDDVRHMLAELEPAPDQVTIAINTSQMNIMELMTDDDIAGTSMQRPELADT
FT                   YREMTVPAGPEWVAEHLRRLQAAGIQPHFQLSSIPQLETVERLIRRGIYTGPVNLTWVA
FT                   IGGGFDGPNPYNMMNFVQRVPDGACLTLETLMRSVLPVNTMAIAMGLHARCGNEDTIWG
FT                   RKGEKMTSVQQIEQLVRIAGELGREVATAKEARDIYRIGETYADTDETLAKLGYAPNRR
FT                   IGQLGFTQHA"
     MHFHDDSLFP ETQDKLVITV APYGPEWEPD DFAEDLPLSM DEHVQQAVDC FNAGATVLHI        60
     HVRELDGKGS KRLSKFNELL GRLREAVPEM ILQVGGSISF APEGEGADAK WLSDDVRHML       120
     AELEPAPDQV TIAINTSQMN IMELMTDDDI AGTSMQRPEL ADTYREMTVP AGPEWVAEHL       180
     RRLQAAGIQP HFQLSSIPQL ETVERLIRRG IYTGPVNLTW VAIGGGFDGP NPYNMMNFVQ       240
     RVPDGACLTL ETLMRSVLPV NTMAIAMGLH ARCGNEDTIW GRKGEKMTSV QQIEQLVRIA       300
     GELGREVATA KEARDIYRIG ETYADTDETL AKLGYAPNRR IGQLGFTQHA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page