(data stored in ACNUC1104 zone)

EMBL: AP008957.PE372

AP008957.PE372       Location/Qualifiers
FT   CDS             411646..412269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31080"
FT                   /db_xref="GOA:C0ZN28"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN28"
FT                   /protein_id="BAH31080.1"
FT                   /translation="MDESPTVVIVPGLRDHVEDHWQTHLARRLDNVLTVPPLETDKLSR
FT                   DARVAALDEVLTSVSSPVVLVAHSAGVMTVAHWARAHHRDVAGALLVTPADLELPLPES
FT                   YPSLEELDRNGWLPIPRQRLPFPSTVAASRNDPLAGYRRVVGLAEGWGSRLLDLGEVGH
FT                   LNPASGYGYWPRAESLVRELRESVSRAASSHATDSDAQVEHSHA"
     MDESPTVVIV PGLRDHVEDH WQTHLARRLD NVLTVPPLET DKLSRDARVA ALDEVLTSVS        60
     SPVVLVAHSA GVMTVAHWAR AHHRDVAGAL LVTPADLELP LPESYPSLEE LDRNGWLPIP       120
     RQRLPFPSTV AASRNDPLAG YRRVVGLAEG WGSRLLDLGE VGHLNPASGY GYWPRAESLV       180
     RELRESVSRA ASSHATDSDA QVEHSHA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page