(data stored in ACNUC1104 zone)

EMBL: AP008957.PE386

AP008957.PE386       Location/Qualifiers
FT   CDS             436125..436559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31094"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN42"
FT                   /protein_id="BAH31094.1"
FT                   /translation="MGQVNAMSSIVVTAAPDKVLAALADYETVRPRILSEQYLDYKVVE
FT                   GGQGDGTVAQWTLKATEKRSRNVKATVTVDGNVITEKDANSSLVTTWTVAPNGTGTTVT
FT                   TLTQWQGATGIGGFFERTFAPKGLQRIQAQVLDNLKRELV"
     MGQVNAMSSI VVTAAPDKVL AALADYETVR PRILSEQYLD YKVVEGGQGD GTVAQWTLKA        60
     TEKRSRNVKA TVTVDGNVIT EKDANSSLVT TWTVAPNGTG TTVTTLTQWQ GATGIGGFFE       120
     RTFAPKGLQR IQAQVLDNLK RELV                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page