(data stored in ACNUC1104 zone)

EMBL: AP008957.PE396

AP008957.PE396       Location/Qualifiers
FT   CDS             443856..444284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31104"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN52"
FT                   /protein_id="BAH31104.1"
FT                   /translation="MSETGSRHTAVPRLTVTDDNDFFFSAAKEGRLEIQRCADCKTLRH
FT                   PPAPACPECRSFSWDTVESTRRCTLHSFTVIHHPKDPAFEYPLAVGLVDLEEGTRLVAD
FT                   IAGIDHEELEFGMELEVAFSEHAHGEMLPQLRRRGSVQ"
     MSETGSRHTA VPRLTVTDDN DFFFSAAKEG RLEIQRCADC KTLRHPPAPA CPECRSFSWD        60
     TVESTRRCTL HSFTVIHHPK DPAFEYPLAV GLVDLEEGTR LVADIAGIDH EELEFGMELE       120
     VAFSEHAHGE MLPQLRRRGS VQ                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page