(data stored in ACNUC1104 zone)

EMBL: AP008957.PE402

AP008957.PE402       Location/Qualifiers
FT   CDS             449124..451334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31110"
FT                   /db_xref="GOA:C0ZN58"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN58"
FT                   /protein_id="BAH31110.1"
FT                   /translation="MALPLLEDHRDLAEAVAAFANRFGGIADTRSNVKRYAAGDRPDSW
FT                   DGLVRQGLHAVHLPEQYGGDGAGLAELAVVVEQLGDALYPGPYVPTVIASGILATAAGP
FT                   AAETMLTELAAGATGAVCTGTRLRAARSDAGWTVSGSADPALGLPGADVVLVRANSEDG
FT                   ELWFRLEPSTSAAVVIEDGVDLTRSIGTLTLTDHQVEAGLIVDGLQAHRTELIVNTVLA
FT                   AEASGIAGWALRTAVDYVKSRQQFGRPVGSFQAVQHKAAMMLVRSEIACAAAWDAARSE
FT                   EHDEDQQKLVSAQAALAALPVGIENALECVTLLGGIGFTWEHDAHLYWRRAISIAAVAG
FT                   SEVKWAHTLGDRSADSERDFSFVDPEMLPELREQVRRVLDEVALLPDDGTTSASWAPAK
FT                   GRARRARFADAKLVAPHYRAPYGLGAGPREQAVIAHEFAMRGWAQPSTVIGEWVLPTIL
FT                   EHGDAEQQDRFVEPSLRADIIWCQLFSEPGAGSDLAGLSTKARKVDGGWVLSGQKVWNS
FT                   GAHEADWGVCLARSDADAPKHRGLSYFLVDMTSKGVDVRPLKQATGKSEFNEVFLDEVF
FT                   VPDDCLVAEPGQGWKLAATTLSNERLSMGSTLHHGSSRLFRQVIADASHDCPREDAVEG
FT                   LGRSISRELALSAMNLRGVSARLAGQEPGAEISVSKVYNALAQREGSRDLLRLLGPRAA
FT                   VVDPSANYAIDHIGLPSILFGGGTVEIQLNVIAQRVLGLPRS"
     MALPLLEDHR DLAEAVAAFA NRFGGIADTR SNVKRYAAGD RPDSWDGLVR QGLHAVHLPE        60
     QYGGDGAGLA ELAVVVEQLG DALYPGPYVP TVIASGILAT AAGPAAETML TELAAGATGA       120
     VCTGTRLRAA RSDAGWTVSG SADPALGLPG ADVVLVRANS EDGELWFRLE PSTSAAVVIE       180
     DGVDLTRSIG TLTLTDHQVE AGLIVDGLQA HRTELIVNTV LAAEASGIAG WALRTAVDYV       240
     KSRQQFGRPV GSFQAVQHKA AMMLVRSEIA CAAAWDAARS EEHDEDQQKL VSAQAALAAL       300
     PVGIENALEC VTLLGGIGFT WEHDAHLYWR RAISIAAVAG SEVKWAHTLG DRSADSERDF       360
     SFVDPEMLPE LREQVRRVLD EVALLPDDGT TSASWAPAKG RARRARFADA KLVAPHYRAP       420
     YGLGAGPREQ AVIAHEFAMR GWAQPSTVIG EWVLPTILEH GDAEQQDRFV EPSLRADIIW       480
     CQLFSEPGAG SDLAGLSTKA RKVDGGWVLS GQKVWNSGAH EADWGVCLAR SDADAPKHRG       540
     LSYFLVDMTS KGVDVRPLKQ ATGKSEFNEV FLDEVFVPDD CLVAEPGQGW KLAATTLSNE       600
     RLSMGSTLHH GSSRLFRQVI ADASHDCPRE DAVEGLGRSI SRELALSAMN LRGVSARLAG       660
     QEPGAEISVS KVYNALAQRE GSRDLLRLLG PRAAVVDPSA NYAIDHIGLP SILFGGGTVE       720
     IQLNVIAQRV LGLPRS                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page