(data stored in ACNUC1104 zone)

EMBL: AP008957.PE413

AP008957.PE413       Location/Qualifiers
FT   CDS             461996..462952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04130"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31121"
FT                   /db_xref="GOA:C0ZN69"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN69"
FT                   /protein_id="BAH31121.1"
FT                   /translation="MMRSIRWIVCSLLIVLAGLGFAGSVLALFVHTQVNDTDSYVESVA
FT                   PLAADPAVQSAVVDRLTEELTQRLDGFPQVVTRQAERLVREAAQSLVSSDQFATLWTAA
FT                   NRRAHAQLAAMVTGRAADGIVRADESGTVTVSLEPVMTELRTNLRDRGFTVIDRLPALD
FT                   PQFEILQSDELVRAQDFSNTLDRAAAWLPWASVACAIAAVVVAPGRMRALSLVGLATAV
FT                   AMIALLVALAVVRRVYLQNSDIPSSEAAVAVYDALAVSLVSSIRVLLACGVAVAVVGYV
FT                   AGGSRSATLMRARISQLIPRGSEANSSTHREVPGPPR"
     MMRSIRWIVC SLLIVLAGLG FAGSVLALFV HTQVNDTDSY VESVAPLAAD PAVQSAVVDR        60
     LTEELTQRLD GFPQVVTRQA ERLVREAAQS LVSSDQFATL WTAANRRAHA QLAAMVTGRA       120
     ADGIVRADES GTVTVSLEPV MTELRTNLRD RGFTVIDRLP ALDPQFEILQ SDELVRAQDF       180
     SNTLDRAAAW LPWASVACAI AAVVVAPGRM RALSLVGLAT AVAMIALLVA LAVVRRVYLQ       240
     NSDIPSSEAA VAVYDALAVS LVSSIRVLLA CGVAVAVVGY VAGGSRSATL MRARISQLIP       300
     RGSEANSSTH REVPGPPR                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page