(data stored in ACNUC1104 zone)

EMBL: AP008957.PE42

AP008957.PE42        Location/Qualifiers
FT   CDS             complement(50870..51946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30750"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI2"
FT                   /protein_id="BAH30750.1"
FT                   /translation="MEAGRRKISAVTNLPLRPIHSSAGHRPYKQAPSRNPFRAMKGTVV
FT                   KKLDYDLVGEQLFSNPKVRARIERHYRLPTDAATASQFLDYAVRHLDQEAMDNPLTQTY
FT                   SNQQVFKAAVNALGSNSRSWASFVKVRDQHLEGLLHGFDPEKTHTAILDGTVTLTDIRE
FT                   HLSGQSGIGDARAIVRWAALLTAQPNYYQQILVIARAFVDLAADADHPLDNEHLMMCLA
FT                   GYLIAPPRRWPGDKHIDTDILLMTPRERDLPGMGYPLASEFLRNLHWNGFKPDRHITRL
FT                   LRLWVPELRDTVDPDVDRLCRLIGSRNQSLRYFLKYSLIGVAITPDGNYSRADNLIWML
FT                   GAYLEKKNKESDVQYIHD"
     MEAGRRKISA VTNLPLRPIH SSAGHRPYKQ APSRNPFRAM KGTVVKKLDY DLVGEQLFSN        60
     PKVRARIERH YRLPTDAATA SQFLDYAVRH LDQEAMDNPL TQTYSNQQVF KAAVNALGSN       120
     SRSWASFVKV RDQHLEGLLH GFDPEKTHTA ILDGTVTLTD IREHLSGQSG IGDARAIVRW       180
     AALLTAQPNY YQQILVIARA FVDLAADADH PLDNEHLMMC LAGYLIAPPR RWPGDKHIDT       240
     DILLMTPRER DLPGMGYPLA SEFLRNLHWN GFKPDRHITR LLRLWVPELR DTVDPDVDRL       300
     CRLIGSRNQS LRYFLKYSLI GVAITPDGNY SRADNLIWML GAYLEKKNKE SDVQYIHD         358
//

If you have problems or comments...

PBIL Back to PBIL home page