(data stored in ACNUC1104 zone)

EMBL: AP008957.PE422

AP008957.PE422       Location/Qualifiers
FT   CDS             471553..472392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31130"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN78"
FT                   /protein_id="BAH31130.1"
FT                   /translation="MVEARLHDGTTIDAEVLGHGPAVLMPVNPISATGIKADELRAWGV
FT                   DPSLGRTFMEGLASNFTVVAFDYEGHRMASPAPDTLTPDNITSDILAVANSAGIDQFAY
FT                   YGYSWLALCGLQLALRTDRLTALVMGGFPPVDGPYKAMLQVTEATHRMTSEPPQRTSQP
FT                   TASSDEFDWNSIDIALTGAQTRQFVTLYRALGEFDDRTIQGRILCPRMCFVGSQDVIEY
FT                   GDRWGGVRVAPADLDLDAARSAGWDIEVLDGLDHTQAMQPAHVLPILKPWLEKVVGV"
     MVEARLHDGT TIDAEVLGHG PAVLMPVNPI SATGIKADEL RAWGVDPSLG RTFMEGLASN        60
     FTVVAFDYEG HRMASPAPDT LTPDNITSDI LAVANSAGID QFAYYGYSWL ALCGLQLALR       120
     TDRLTALVMG GFPPVDGPYK AMLQVTEATH RMTSEPPQRT SQPTASSDEF DWNSIDIALT       180
     GAQTRQFVTL YRALGEFDDR TIQGRILCPR MCFVGSQDVI EYGDRWGGVR VAPADLDLDA       240
     ARSAGWDIEV LDGLDHTQAM QPAHVLPILK PWLEKVVGV                              279
//

If you have problems or comments...

PBIL Back to PBIL home page