(data stored in ACNUC1104 zone)

EMBL: AP008957.PE427

AP008957.PE427       Location/Qualifiers
FT   CDS             complement(476740..477837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04270"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31135"
FT                   /db_xref="GOA:C0ZN83"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN83"
FT                   /protein_id="BAH31135.1"
FT                   /translation="MTRPDGRDVRDLLGMHSRAARFMAACFALTCVISVAYTSSDVRAV
FT                   WPMVLAIIVCSTAAFTLVLSRGDPMPLGQSVLVSLTGAVTSGLVLSVVPVPVNDMTQLW
FT                   MFGMSTAVFTFMCVRGRTALAWLGLGLMVLVTAIWSSTTGQGAMYGVSLTVINAGPVLM
FT                   STFFAYTIRPQARVIYELREQSTQRIASASASAAILEERDAQLDRLDLLARPLLERVAS
FT                   GIPLTTAERQECELLEAQLRDSLRAPGLQQTDVIDAVHATRNRGVEVVLLDDHGMDGAD
FT                   PAVRDRIHASIVRELTAITRGKVTIRILPPRRTAMATILVDTEDVRRIEFDHNGMQLLR
FT                   QGDQRELGASSMSVHPTTDSAVYPE"
     MTRPDGRDVR DLLGMHSRAA RFMAACFALT CVISVAYTSS DVRAVWPMVL AIIVCSTAAF        60
     TLVLSRGDPM PLGQSVLVSL TGAVTSGLVL SVVPVPVNDM TQLWMFGMST AVFTFMCVRG       120
     RTALAWLGLG LMVLVTAIWS STTGQGAMYG VSLTVINAGP VLMSTFFAYT IRPQARVIYE       180
     LREQSTQRIA SASASAAILE ERDAQLDRLD LLARPLLERV ASGIPLTTAE RQECELLEAQ       240
     LRDSLRAPGL QQTDVIDAVH ATRNRGVEVV LLDDHGMDGA DPAVRDRIHA SIVRELTAIT       300
     RGKVTIRILP PRRTAMATIL VDTEDVRRIE FDHNGMQLLR QGDQRELGAS SMSVHPTTDS       360
     AVYPE                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page