(data stored in ACNUC1104 zone)

EMBL: AP008957.PE434

AP008957.PE434       Location/Qualifiers
FT   CDS             484099..484701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31142"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN90"
FT                   /protein_id="BAH31142.1"
FT                   /translation="MSDPPPWPASVRATLWWHRSTPAARELGPDDRTIPVTVAMMVDYL
FT                   DSPVGPYREILASPVLHAPGKRIGPMPRMAVPFVAVDSEPSVHGGRVHWQLPKVLAEFD
FT                   GDVQQKFTATGDGWRVRSDTRMLGPRLPIAGALGFAQPESGGGLAIASARLTGSFRYAR
FT                   VSVEAEGPTLPNWLASGTHHGAVILGGKMTTGAAKHR"
     MSDPPPWPAS VRATLWWHRS TPAARELGPD DRTIPVTVAM MVDYLDSPVG PYREILASPV        60
     LHAPGKRIGP MPRMAVPFVA VDSEPSVHGG RVHWQLPKVL AEFDGDVQQK FTATGDGWRV       120
     RSDTRMLGPR LPIAGALGFA QPESGGGLAI ASARLTGSFR YARVSVEAEG PTLPNWLASG       180
     THHGAVILGG KMTTGAAKHR                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page