(data stored in ACNUC1104 zone)

EMBL: AP008957.PE440

AP008957.PE440       Location/Qualifiers
FT   CDS             complement(490966..491883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31148"
FT                   /db_xref="GOA:C0ZN96"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN96"
FT                   /protein_id="BAH31148.1"
FT                   /translation="MRREDVEFSSDGVTVRGWLYRPDTDEDVPAVVLAGGWCYVRELVM
FT                   PYYAEAFVTAGMAALVFDYRNLGVSDGEPRQHLDPKQQIRDYQNALSFLERTPGIDNDR
FT                   LGAWGISYSGGHVMILAATDPRVKAIVSQIPVIDGFRNMRRIHGTMGYRKLWDAILEDR
FT                   RLRFDDPDQRLHIAHASENPEEELSSWPFPETKTTFAALQATEAPLYQNSSTMESVDLL
FT                   LDYDVNYFVPRILDTPSMMIVAEGDDLTLWDLEIESYNSIPTPKKELVVLPHTSHMTLY
FT                   SDQSKLAVAAEHASRWFTTHLLAK"
     MRREDVEFSS DGVTVRGWLY RPDTDEDVPA VVLAGGWCYV RELVMPYYAE AFVTAGMAAL        60
     VFDYRNLGVS DGEPRQHLDP KQQIRDYQNA LSFLERTPGI DNDRLGAWGI SYSGGHVMIL       120
     AATDPRVKAI VSQIPVIDGF RNMRRIHGTM GYRKLWDAIL EDRRLRFDDP DQRLHIAHAS       180
     ENPEEELSSW PFPETKTTFA ALQATEAPLY QNSSTMESVD LLLDYDVNYF VPRILDTPSM       240
     MIVAEGDDLT LWDLEIESYN SIPTPKKELV VLPHTSHMTL YSDQSKLAVA AEHASRWFTT       300
     HLLAK                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page