(data stored in ACNUC1104 zone)

EMBL: AP008957.PE443

AP008957.PE443       Location/Qualifiers
FT   CDS             494127..495746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04430"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31151"
FT                   /db_xref="GOA:C0ZN99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN99"
FT                   /protein_id="BAH31151.1"
FT                   /translation="MLSATRPRAMTGGGVLPEMLLDALRRDPEALALVDESVRWTYQEL
FT                   VDAATSFAGALHKSGFEPGEVVLVQLPNWWESVVAAWGTWLAGGILLPVVPIYRAHELS
FT                   FIIEQAEPSVIVAPQEYRGYRHVEQLGTVLRDLGREVLLVEARGEGGLRRTTFDDFLDF
FT                   GMEANRPDHRADPDDVALVLYTSGTTSAPKGVLHTHRTLMAESSSMIAHCGVDSQDRIF
FT                   MPSPLPHITGMSYAVVLPAAAACSTVLMQRWNPAEAVALIEREQCTFTVSATPFLRGLA
FT                   DAYEEDGYRRSHLTRFVCGGAGIPPELVRRAHRVMGTAVVRTYGSTELPTLVMGDPFGD
FT                   IGLQAEDEGAVIGGNEFRLGEDDELLVRGPELFVGYVDSSINAESFTEDGYFRTGDVAT
FT                   VDGPGQIRITSRIKDIINRGGEKFSAADIEWVLEAHPNVAEVAVVGYPDEELGERACAF
FT                   VVPHGEPPSVRDLRIFLLSEGFAVQKAPERVETVASLPRTESGKVQKFLLRRALGLGSA
FT                   QAVPETYGSEFGHDGNRRKATS"
     MLSATRPRAM TGGGVLPEML LDALRRDPEA LALVDESVRW TYQELVDAAT SFAGALHKSG        60
     FEPGEVVLVQ LPNWWESVVA AWGTWLAGGI LLPVVPIYRA HELSFIIEQA EPSVIVAPQE       120
     YRGYRHVEQL GTVLRDLGRE VLLVEARGEG GLRRTTFDDF LDFGMEANRP DHRADPDDVA       180
     LVLYTSGTTS APKGVLHTHR TLMAESSSMI AHCGVDSQDR IFMPSPLPHI TGMSYAVVLP       240
     AAAACSTVLM QRWNPAEAVA LIEREQCTFT VSATPFLRGL ADAYEEDGYR RSHLTRFVCG       300
     GAGIPPELVR RAHRVMGTAV VRTYGSTELP TLVMGDPFGD IGLQAEDEGA VIGGNEFRLG       360
     EDDELLVRGP ELFVGYVDSS INAESFTEDG YFRTGDVATV DGPGQIRITS RIKDIINRGG       420
     EKFSAADIEW VLEAHPNVAE VAVVGYPDEE LGERACAFVV PHGEPPSVRD LRIFLLSEGF       480
     AVQKAPERVE TVASLPRTES GKVQKFLLRR ALGLGSAQAV PETYGSEFGH DGNRRKATS        539
//

If you have problems or comments...

PBIL Back to PBIL home page