(data stored in ACNUC1104 zone)

EMBL: AP008957.PE444

AP008957.PE444       Location/Qualifiers
FT   CDS             495880..496443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04440"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31152"
FT                   /db_xref="GOA:C0ZNA0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA0"
FT                   /protein_id="BAH31152.1"
FT                   /translation="MGTSVGKTVRAERTRQGIPVRELARRLGVSPSFLSQFELGQSQAA
FT                   VNTLFAIATELNLSLDVLLGNSVDPERESESESKTHEPRISDCLTFRSGVRWQRLANTP
FT                   ENHHVQFLLTEYEPGADSAPGDAPQTHSGDDYGYVLEGTLTIDIDGMRRLLKSGEAIHL
FT                   VGNVPHRLRNETDQTVKAIWFVLG"
     MGTSVGKTVR AERTRQGIPV RELARRLGVS PSFLSQFELG QSQAAVNTLF AIATELNLSL        60
     DVLLGNSVDP ERESESESKT HEPRISDCLT FRSGVRWQRL ANTPENHHVQ FLLTEYEPGA       120
     DSAPGDAPQT HSGDDYGYVL EGTLTIDIDG MRRLLKSGEA IHLVGNVPHR LRNETDQTVK       180
     AIWFVLG                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page