(data stored in ACNUC1104 zone)

EMBL: AP008957.PE451

AP008957.PE451       Location/Qualifiers
FT   CDS             502642..503154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31159"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA7"
FT                   /protein_id="BAH31159.1"
FT                   /translation="MRPRREFENVRSRRTTMTRLKVNGKRASRTGVVVASVAVLGMAVA
FT                   PGIAWASNPISDGSPVAVRSIATAPSEAGVAPEVACGAATPISDEELQKLIDEGKVVRA
FT                   EEAGTAAITIEVPGDAATFIAREGVPALPTVESAPAIEGVPAEVLNMAGVAPLEEGVAL
FT                   SCAVAAG"
     MRPRREFENV RSRRTTMTRL KVNGKRASRT GVVVASVAVL GMAVAPGIAW ASNPISDGSP        60
     VAVRSIATAP SEAGVAPEVA CGAATPISDE ELQKLIDEGK VVRAEEAGTA AITIEVPGDA       120
     ATFIAREGVP ALPTVESAPA IEGVPAEVLN MAGVAPLEEG VALSCAVAAG                  170
//

If you have problems or comments...

PBIL Back to PBIL home page