(data stored in ACNUC1104 zone)

EMBL: AP008957.PE458

AP008957.PE458       Location/Qualifiers
FT   CDS             510297..511853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="RER_04580"
FT                   /product="probable fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31166"
FT                   /db_xref="GOA:C0ZNB4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB4"
FT                   /protein_id="BAH31166.1"
FT                   /translation="MTLNIADLFEAVADAIPDRVPLILEDARLNYAELELRSNRLAHHL
FT                   QSVGVEPGQHVGIHMRNCVEYVEALLACLKIRAVPINVNFRYTDAELLYIYTNSQMVAL
FT                   LVEEEFAPTALAVVPQCPEISHVLIVGDDYENALAAQTDARDFGPRSNDDHFIIYTGGT
FT                   TGMPKGVVWRHEDFFFAALSGANLSGPPRRSLEEVVDAAVANTNPTVLLLIPPLMHGAA
FT                   IYSLLTAFLMGAPRVLTRSFDPMEVLRLVEAEKITGITVVGDAIARPIADAIAASEGRY
FT                   DLSTLKLIGSGGALFSPNLKAELTTRLPGLVIKDAFGASESGNDGVVEFGEDGSKRIRS
FT                   NPNMILVDDEFRRIEPGSGTTGFIARAGHVPVAYFDDPAKTAATFPVVDGVRLAVLGDM
FT                   GTMEADGTIVLLGRGSMCINSGGEKVYPEEVEQALKTHPAVFDALVAGAPDARFGEKVA
FT                   AVVQVRPGFEDVATESLSEHCRTHVAGYKIPRSIVLVPSILRSPSGKADYRWARETVAG
FT                   V"
     MTLNIADLFE AVADAIPDRV PLILEDARLN YAELELRSNR LAHHLQSVGV EPGQHVGIHM        60
     RNCVEYVEAL LACLKIRAVP INVNFRYTDA ELLYIYTNSQ MVALLVEEEF APTALAVVPQ       120
     CPEISHVLIV GDDYENALAA QTDARDFGPR SNDDHFIIYT GGTTGMPKGV VWRHEDFFFA       180
     ALSGANLSGP PRRSLEEVVD AAVANTNPTV LLLIPPLMHG AAIYSLLTAF LMGAPRVLTR       240
     SFDPMEVLRL VEAEKITGIT VVGDAIARPI ADAIAASEGR YDLSTLKLIG SGGALFSPNL       300
     KAELTTRLPG LVIKDAFGAS ESGNDGVVEF GEDGSKRIRS NPNMILVDDE FRRIEPGSGT       360
     TGFIARAGHV PVAYFDDPAK TAATFPVVDG VRLAVLGDMG TMEADGTIVL LGRGSMCINS       420
     GGEKVYPEEV EQALKTHPAV FDALVAGAPD ARFGEKVAAV VQVRPGFEDV ATESLSEHCR       480
     THVAGYKIPR SIVLVPSILR SPSGKADYRW ARETVAGV                               518
//

If you have problems or comments...

PBIL Back to PBIL home page