(data stored in ACNUC1104 zone)

EMBL: AP008957.PE459

AP008957.PE459       Location/Qualifiers
FT   CDS             511894..513312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31167"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB5"
FT                   /protein_id="BAH31167.1"
FT                   /translation="MCVTGNDAGAGHVFVVRGRLESVDWDAAVVSTSGNFVPREHWWPA
FT                   LGLTSPVERAPAGGNRVRSFPKDGRPAWLLNVASRISVSWLVDGVYEVLDAIASADIRP
FT                   GGRRVKPLVALPTFGVGSGGQGMVRGHVIKALIETAVECADKYDFDIAFVVANAADYAA
FT                   YQSIRRGHLLSAGIPPQVQQLADRLQTGEASLLLGAGVSIPAGLPSWDSLLEAIRQKEL
FT                   PGVSSAEFAELNVLDRAQLLSKELQTEDDGSNDLGERVVQLTGVDIKPTLSHCLLASLR
FT                   VKKVVTTNYDALYERAFESAHGENSVAVLPREEARAGVPWVLKLHGDVADASSIVLSRR
FT                   DFVRYDAERRPLGSIVQSLMATGHLIVVGASMTDDNVLRLAHEVLALDARNKRPRTLGT
FT                   VITLQRDEIRTALWKNDFDYVAVSDSLDQQVAARDLEIFLDKLAILTSVDAPYLLDTHT
FT                   KGCSRGEKSVWQKI"
     MCVTGNDAGA GHVFVVRGRL ESVDWDAAVV STSGNFVPRE HWWPALGLTS PVERAPAGGN        60
     RVRSFPKDGR PAWLLNVASR ISVSWLVDGV YEVLDAIASA DIRPGGRRVK PLVALPTFGV       120
     GSGGQGMVRG HVIKALIETA VECADKYDFD IAFVVANAAD YAAYQSIRRG HLLSAGIPPQ       180
     VQQLADRLQT GEASLLLGAG VSIPAGLPSW DSLLEAIRQK ELPGVSSAEF AELNVLDRAQ       240
     LLSKELQTED DGSNDLGERV VQLTGVDIKP TLSHCLLASL RVKKVVTTNY DALYERAFES       300
     AHGENSVAVL PREEARAGVP WVLKLHGDVA DASSIVLSRR DFVRYDAERR PLGSIVQSLM       360
     ATGHLIVVGA SMTDDNVLRL AHEVLALDAR NKRPRTLGTV ITLQRDEIRT ALWKNDFDYV       420
     AVSDSLDQQV AARDLEIFLD KLAILTSVDA PYLLDTHTKG CSRGEKSVWQ KI               472
//

If you have problems or comments...

PBIL Back to PBIL home page