(data stored in ACNUC1104 zone)

EMBL: AP008957.PE46

AP008957.PE46        Location/Qualifiers
FT   CDS             55371..56867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30754"
FT                   /db_xref="GOA:C0ZLI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI6"
FT                   /protein_id="BAH30754.1"
FT                   /translation="MLQRLRGDWSGRGQVLLKTKSTQTGSRRDIWRLTPDAGSLLEEKK
FT                   KADDKGAVRIVDLALWFGRNLDIDSVTPNAVGGLDGSVHDIDRLIFWFKQKFGLPAGDL
FT                   VGTLYSDDVPAEYRETQFEAEPVGEDTLELLGSLPPAPTVGMNLGELVVLLEQSLEKGG
FT                   YQLPPGLVRRVLTAWLRGDIVILVGQPGTGKTLFATLLAGEMASLLQLDSPITVAVRAD
FT                   FDETEFIGYERLDGTPELRQFAQDVLMTENPLEAKIVVLEEFNLAAIETYLASVLVATQ
FT                   EQTRQIQLPGGTTGKLPVDTFVLATCNSFRDEPETRMRISSPTKRRSTIITMPNVLGDR
FT                   FDEDPGNAVLSLVSGLVGVESNRVAKRQADSRPSQFDSLRGAALTTVKTLDDLSDGVKK
FT                   HLVDVSGAILGTSTGRSWFTMGLLRDVVLAITHADRSESAELLALGEAVADKLIHQVRG
FT                   THSDIEELREVCANLPNAGEIATMIDRMMDGPSDELLPLL"
     MLQRLRGDWS GRGQVLLKTK STQTGSRRDI WRLTPDAGSL LEEKKKADDK GAVRIVDLAL        60
     WFGRNLDIDS VTPNAVGGLD GSVHDIDRLI FWFKQKFGLP AGDLVGTLYS DDVPAEYRET       120
     QFEAEPVGED TLELLGSLPP APTVGMNLGE LVVLLEQSLE KGGYQLPPGL VRRVLTAWLR       180
     GDIVILVGQP GTGKTLFATL LAGEMASLLQ LDSPITVAVR ADFDETEFIG YERLDGTPEL       240
     RQFAQDVLMT ENPLEAKIVV LEEFNLAAIE TYLASVLVAT QEQTRQIQLP GGTTGKLPVD       300
     TFVLATCNSF RDEPETRMRI SSPTKRRSTI ITMPNVLGDR FDEDPGNAVL SLVSGLVGVE       360
     SNRVAKRQAD SRPSQFDSLR GAALTTVKTL DDLSDGVKKH LVDVSGAILG TSTGRSWFTM       420
     GLLRDVVLAI THADRSESAE LLALGEAVAD KLIHQVRGTH SDIEELREVC ANLPNAGEIA       480
     TMIDRMMDGP SDELLPLL                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page