(data stored in ACNUC1104 zone)

EMBL: AP008957.PE468

AP008957.PE468       Location/Qualifiers
FT   CDS             521144..521614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31176"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNC4"
FT                   /protein_id="BAH31176.1"
FT                   /translation="MAEATQTWSERLAELGIALPAVAAPVAAYVPAVRSGNHVYTSGQL
FT                   PFVDGKLALTGKLGAGVSDEDAKAAARTCALNALAAIDALVGIDNVVRVVKVVGFVASA
FT                   EGFTGQPGVINGASEFLGEVLGDAGIHARSAVGVAELPLGSPVEVELIVEVR"
     MAEATQTWSE RLAELGIALP AVAAPVAAYV PAVRSGNHVY TSGQLPFVDG KLALTGKLGA        60
     GVSDEDAKAA ARTCALNALA AIDALVGIDN VVRVVKVVGF VASAEGFTGQ PGVINGASEF       120
     LGEVLGDAGI HARSAVGVAE LPLGSPVEVE LIVEVR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page