(data stored in ACNUC1104 zone)

EMBL: AP008957.PE47

AP008957.PE47        Location/Qualifiers
FT   CDS             complement(56864..58381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30755"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI7"
FT                   /protein_id="BAH30755.1"
FT                   /translation="MTFECSAFGAPSFPKSGSQIPPNLVLGDADHMKKLNVRLISGVRE
FT                   WELGDLPRIVPAGQIVLAVRGNGSSTILLDGHRTRLTSGLVGIDLTRSTGYHRLDIEGR
FT                   TFWFGTQDAKLQLDGIEAMLNELGNQGTGWGGQVLFSDGAGLRNPHVVYGWLDEWAEST
FT                   LTAVESVLASPRPRTTRSEVLSRRGGSGVLRAPTLRLLRSAPKQYLSPDPNGALQMSDG
FT                   SRYTPLRVVVRKRSTSLDTIANRRAVALLTWLIRLNEEVLENKPSNTARVRCRLWLNRA
FT                   QTLARRPLAQALRSVGPGIEQSRQAEETTDAPYRMCYAATTDLRRLFAWSATSKPLGRY
FT                   SYVDRSDEIYQAYAASRLAKELGMQQTHPVLGSERLAFTGERFDMYYDTTSPPSVLRSW
FT                   RAQSLRPDDSRPDLLIHEKATGRVAVLDAKYRVARDGGASEDSRKEVTAYLGLYGISSI
FT                   SILFPGDGDAVTVSGHGRSIHEIPLRPGSDLSAAVPLILGSFSLPPF"
     MTFECSAFGA PSFPKSGSQI PPNLVLGDAD HMKKLNVRLI SGVREWELGD LPRIVPAGQI        60
     VLAVRGNGSS TILLDGHRTR LTSGLVGIDL TRSTGYHRLD IEGRTFWFGT QDAKLQLDGI       120
     EAMLNELGNQ GTGWGGQVLF SDGAGLRNPH VVYGWLDEWA ESTLTAVESV LASPRPRTTR       180
     SEVLSRRGGS GVLRAPTLRL LRSAPKQYLS PDPNGALQMS DGSRYTPLRV VVRKRSTSLD       240
     TIANRRAVAL LTWLIRLNEE VLENKPSNTA RVRCRLWLNR AQTLARRPLA QALRSVGPGI       300
     EQSRQAEETT DAPYRMCYAA TTDLRRLFAW SATSKPLGRY SYVDRSDEIY QAYAASRLAK       360
     ELGMQQTHPV LGSERLAFTG ERFDMYYDTT SPPSVLRSWR AQSLRPDDSR PDLLIHEKAT       420
     GRVAVLDAKY RVARDGGASE DSRKEVTAYL GLYGISSISI LFPGDGDAVT VSGHGRSIHE       480
     IPLRPGSDLS AAVPLILGSF SLPPF                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page