(data stored in ACNUC1104 zone)

EMBL: AP008957.PE479

AP008957.PE479       Location/Qualifiers
FT   CDS             complement(531380..531850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31187"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND5"
FT                   /protein_id="BAH31187.1"
FT                   /translation="MTVRAPIPPFTHETAVQKVRLAEDGWNSRDPHKVSLAYTPDSWWR
FT                   NRSTFVTGRSEIVELLTEKWTRELDYRLIKELWAHGDDRIAVRFAYEWHDHDGQWFRSY
FT                   GNENWEFDADGLMHHRHASINDVPIAESERKFFWDSTGPRPHDHPGLSELGL"
     MTVRAPIPPF THETAVQKVR LAEDGWNSRD PHKVSLAYTP DSWWRNRSTF VTGRSEIVEL        60
     LTEKWTRELD YRLIKELWAH GDDRIAVRFA YEWHDHDGQW FRSYGNENWE FDADGLMHHR       120
     HASINDVPIA ESERKFFWDS TGPRPHDHPG LSELGL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page