(data stored in ACNUC1104 zone)

EMBL: AP008957.PE48

AP008957.PE48        Location/Qualifiers
FT   CDS             complement(58426..59433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30756"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI8"
FT                   /protein_id="BAH30756.1"
FT                   /translation="MKERLVTYWAVAQPGSVSGEVLVRDGYIVGDDAAIAQIAEAGVQL
FT                   VAAADGSRPMIWVSLGSANVRVPGFADQTLDRAGLEAEIRRRVTEEENAQRRSAVEAMS
FT                   EGSSHARSAMHSTPTSSVRDQWSRITEWLRVHFPATTITGADRRSVDAAMAKTGQSWPA
FT                   ELIELYTLVDRVSDERLLGLLHRFALLTLDDALWHWESSIQIWDESARLYGGGPVDVPA
FT                   EAGFQADTFIPAFVPFAGMDGNFLCIETRHGLMHGCVTEFDKSGADEPGPRWISISALL
FT                   SDLADSLTASHAFDDGWYCTTDNGALEWEPDRTWRLRQLHTCQLRASTENKIDR"
     MKERLVTYWA VAQPGSVSGE VLVRDGYIVG DDAAIAQIAE AGVQLVAAAD GSRPMIWVSL        60
     GSANVRVPGF ADQTLDRAGL EAEIRRRVTE EENAQRRSAV EAMSEGSSHA RSAMHSTPTS       120
     SVRDQWSRIT EWLRVHFPAT TITGADRRSV DAAMAKTGQS WPAELIELYT LVDRVSDERL       180
     LGLLHRFALL TLDDALWHWE SSIQIWDESA RLYGGGPVDV PAEAGFQADT FIPAFVPFAG       240
     MDGNFLCIET RHGLMHGCVT EFDKSGADEP GPRWISISAL LSDLADSLTA SHAFDDGWYC       300
     TTDNGALEWE PDRTWRLRQL HTCQLRASTE NKIDR                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page