(data stored in ACNUC1104 zone)

EMBL: AP008957.PE481

AP008957.PE481       Location/Qualifiers
FT   CDS             532923..533153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31189"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZND7"
FT                   /protein_id="BAH31189.1"
FT                   /translation="MCPNFAQAGALGSLRLTALPLPVEASERMGKPIACQAGDVVVTCL
FT                   IEEVFYFVLLNREPTQSPFDSFHRQGKEHQQ"
     MCPNFAQAGA LGSLRLTALP LPVEASERMG KPIACQAGDV VVTCLIEEVF YFVLLNREPT        60
     QSPFDSFHRQ GKEHQQ                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page