(data stored in ACNUC1104 zone)

EMBL: AP008957.PE49

AP008957.PE49        Location/Qualifiers
FT   CDS             59746..60306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30757"
FT                   /db_xref="InterPro:IPR025447"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI9"
FT                   /protein_id="BAH30757.1"
FT                   /translation="MVPRNFFATRTLPPKFSRPRGGTPTPHADAIPLCQKAKKLAGHEA
FT                   RSLSQQGERHAEHPFEDRHRRLGRNPGIARIRPVNSVVMIALTGSPATLAFVARTDVVG
FT                   ADAAADYGTALEQAAATSVIWVVVGTGPVAAAELDQIEAAQRELDSMGIRSIRTLVAES
FT                   LEIGAEWFDTNGEVPDQQCMFCV"
     MVPRNFFATR TLPPKFSRPR GGTPTPHADA IPLCQKAKKL AGHEARSLSQ QGERHAEHPF        60
     EDRHRRLGRN PGIARIRPVN SVVMIALTGS PATLAFVART DVVGADAAAD YGTALEQAAA       120
     TSVIWVVVGT GPVAAAELDQ IEAAQRELDS MGIRSIRTLV AESLEIGAEW FDTNGEVPDQ       180
     QCMFCV                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page