(data stored in ACNUC1104 zone)

EMBL: AP008957.PE490

AP008957.PE490       Location/Qualifiers
FT   CDS             complement(541028..542713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04900"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31198"
FT                   /db_xref="GOA:C0ZNE6"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE6"
FT                   /protein_id="BAH31198.1"
FT                   /translation="MTAVNEQVSAGAPDRADLGENAALKETLEDYTLRFAPRSYRKWGT
FT                   GVVATSALGGIAYLADFSIGANIGISYGTGNALLGIAVFAVVIMATGFPLAYYAARYNI
FT                   DLDLITRGSGFGYYGSVVTNVIFATFTFIFFALEGSIMAQGLKLGLGIPLSIGYAVSTL
FT                   MVIPLVIYGMKALAKLQVWTTPLWLVMMVLPFLYLLFKHPDSVSAFFAFGGEDGANGKG
FT                   VNFGSVMLAAGVCLSLIAQIAEQIDYLRFMPPKTPENTRRWWAAVILAGPGWVIFGAFK
FT                   QIVGLFLAVYIIANVVDGSSIANQPVHQFLEIYQDMMPHWLAMTLAVILVVISQIKINV
FT                   TNAYSGSLAWTNSYTRVTKTYPGRMIFVLVNLAIALILMEANMFDFLNTILGFYANCGI
FT                   AWVVVVASDIAINKYWLKLSPKVPEFRRGMLYDVNPVGFVSMLLAAGISILVFFGAFGS
FT                   AIKPFSPIVAIVIALVMPPVLAVATKGKYYLRRTDDGIDLPMFDEYGNPSGETLLCCVS
FT                   GIEFERPDMLASNVPGPNGEKQYISSLALSTDKTGEHVLPAQLP"
     MTAVNEQVSA GAPDRADLGE NAALKETLED YTLRFAPRSY RKWGTGVVAT SALGGIAYLA        60
     DFSIGANIGI SYGTGNALLG IAVFAVVIMA TGFPLAYYAA RYNIDLDLIT RGSGFGYYGS       120
     VVTNVIFATF TFIFFALEGS IMAQGLKLGL GIPLSIGYAV STLMVIPLVI YGMKALAKLQ       180
     VWTTPLWLVM MVLPFLYLLF KHPDSVSAFF AFGGEDGANG KGVNFGSVML AAGVCLSLIA       240
     QIAEQIDYLR FMPPKTPENT RRWWAAVILA GPGWVIFGAF KQIVGLFLAV YIIANVVDGS       300
     SIANQPVHQF LEIYQDMMPH WLAMTLAVIL VVISQIKINV TNAYSGSLAW TNSYTRVTKT       360
     YPGRMIFVLV NLAIALILME ANMFDFLNTI LGFYANCGIA WVVVVASDIA INKYWLKLSP       420
     KVPEFRRGML YDVNPVGFVS MLLAAGISIL VFFGAFGSAI KPFSPIVAIV IALVMPPVLA       480
     VATKGKYYLR RTDDGIDLPM FDEYGNPSGE TLLCCVSGIE FERPDMLASN VPGPNGEKQY       540
     ISSLALSTDK TGEHVLPAQL P                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page