(data stored in ACNUC1104 zone)

EMBL: AP008957.PE498

AP008957.PE498       Location/Qualifiers
FT   CDS             551401..552327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04980"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31206"
FT                   /db_xref="GOA:C0ZNF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF4"
FT                   /protein_id="BAH31206.1"
FT                   /translation="MLWYIGRRVLQMIPVFLGATLLIYAMVFLLPGDPIAALAGDKALS
FT                   PAVAAQLRERYHLDLPFYQQYLLYLKGIFTLDFGTSFSGRPVSEVLAQAFPITMKLAFM
FT                   ALIVETVFGVGFGLIAGLRKGGFFDSTVLLFSLVLIAIPIFVIGFLAQFFIGVKWGIVP
FT                   PTVGGNTSFTNLLLPALVLGSVSFAYVLRLTRTSVAENLTADYVRTATAKGLSRGRVVR
FT                   VHVLRNSLIPVVTFLGADLATLMGGAIVTEGIFNINGVGGTIYQAVTRGEAPTVVSFVT
FT                   ILIVIYLIANLLVDLLYAALDPRIRYV"
     MLWYIGRRVL QMIPVFLGAT LLIYAMVFLL PGDPIAALAG DKALSPAVAA QLRERYHLDL        60
     PFYQQYLLYL KGIFTLDFGT SFSGRPVSEV LAQAFPITMK LAFMALIVET VFGVGFGLIA       120
     GLRKGGFFDS TVLLFSLVLI AIPIFVIGFL AQFFIGVKWG IVPPTVGGNT SFTNLLLPAL       180
     VLGSVSFAYV LRLTRTSVAE NLTADYVRTA TAKGLSRGRV VRVHVLRNSL IPVVTFLGAD       240
     LATLMGGAIV TEGIFNINGV GGTIYQAVTR GEAPTVVSFV TILIVIYLIA NLLVDLLYAA       300
     LDPRIRYV                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page