(data stored in ACNUC1104 zone)

EMBL: AP008957.PE501

AP008957.PE501       Location/Qualifiers
FT   CDS             555063..555812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31209"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF7"
FT                   /protein_id="BAH31209.1"
FT                   /translation="MTDPLQPLVDLPGVRAAADHARDALGEVHRHKTNRRGWPTTAAEA
FT                   AVRAARASASLAGGTTELPAEGMAGDPILAGALRVAQALDGDSLPLMESTWKRAPLQAL
FT                   ARLHLLAAADLVEDADQLGRPRSDRGVGERLDALAQLVTGGTSAPAPVLAAVVHGELLA
FT                   LSPFGTADGIVARAASRLVAVSSGLDPHNLGVPEVSWLRRPQAYTDGAAGFASGNPAGV
FT                   GSWVILCCGALEAGAREATSIADAATG"
     MTDPLQPLVD LPGVRAAADH ARDALGEVHR HKTNRRGWPT TAAEAAVRAA RASASLAGGT        60
     TELPAEGMAG DPILAGALRV AQALDGDSLP LMESTWKRAP LQALARLHLL AAADLVEDAD       120
     QLGRPRSDRG VGERLDALAQ LVTGGTSAPA PVLAAVVHGE LLALSPFGTA DGIVARAASR       180
     LVAVSSGLDP HNLGVPEVSW LRRPQAYTDG AAGFASGNPA GVGSWVILCC GALEAGAREA       240
     TSIADAATG                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page