(data stored in ACNUC1104 zone)

EMBL: AP008957.PE502

AP008957.PE502       Location/Qualifiers
FT   CDS             complement(556203..557021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31210"
FT                   /db_xref="GOA:C0ZNF8"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF8"
FT                   /protein_id="BAH31210.1"
FT                   /translation="MTDKPANGLNTGRTAAFFDLDKTIIAKSSTLAFSKPFFAQGLINR
FT                   RSVLKSSYAQFLFLLSGADHDQMERMREHLTAMCAGWDVEQVKAIVAETLHDIVDPLVF
FT                   AEAADLIADHKLRGHDVIVVSASGEEIVAPIARALGATHSVATSMREEDGHYTGEVDFY
FT                   CYGPGKVEAMEKLAAEYGYDLAASYAYSDSVTDLPMLEAVGHPTAVNPDRALRKEAAVN
FT                   GWPILTFSNPVSLRARLSAQSTTTVATTAAVGIAALVAGAMTFGLLRRKR"
     MTDKPANGLN TGRTAAFFDL DKTIIAKSST LAFSKPFFAQ GLINRRSVLK SSYAQFLFLL        60
     SGADHDQMER MREHLTAMCA GWDVEQVKAI VAETLHDIVD PLVFAEAADL IADHKLRGHD       120
     VIVVSASGEE IVAPIARALG ATHSVATSMR EEDGHYTGEV DFYCYGPGKV EAMEKLAAEY       180
     GYDLAASYAY SDSVTDLPML EAVGHPTAVN PDRALRKEAA VNGWPILTFS NPVSLRARLS       240
     AQSTTTVATT AAVGIAALVA GAMTFGLLRR KR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page