(data stored in ACNUC1104 zone)

EMBL: AP008957.PE506

AP008957.PE506       Location/Qualifiers
FT   CDS             560388..560972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31214"
FT                   /db_xref="GOA:C0ZNG2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG2"
FT                   /protein_id="BAH31214.1"
FT                   /translation="MSWASVAMIALALAIIPARRGASARAAEILFADTTTENSVAAPDK
FT                   PDPLAVAASLDLLGACLRAGLPVSAAITAMASTAPKPMADTLSRVADLLTLGADPDAAW
FT                   SEAALDPDTEALARMARRSARSGSSLSSSMAELAERSRGDAEDLAAAAAERAGVLISGP
FT                   LGLCFLPAFIALGIVPVVIGLATTVLGNGLL"
     MSWASVAMIA LALAIIPARR GASARAAEIL FADTTTENSV AAPDKPDPLA VAASLDLLGA        60
     CLRAGLPVSA AITAMASTAP KPMADTLSRV ADLLTLGADP DAAWSEAALD PDTEALARMA       120
     RRSARSGSSL SSSMAELAER SRGDAEDLAA AAAERAGVLI SGPLGLCFLP AFIALGIVPV       180
     VIGLATTVLG NGLL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page