(data stored in ACNUC1104 zone)

EMBL: AP008957.PE511

AP008957.PE511       Location/Qualifiers
FT   CDS             564700..564903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05110"
FT                   /product="probable cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31219"
FT                   /db_xref="GOA:C0ZNG7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG7"
FT                   /protein_id="BAH31219.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAPEDGSADVFVHYSEIQGNGFRTLEEN
FT                   QRVEFEVGQGTKGPQATGVRAV"
     MAQGTVKWFN AEKGFGFIAP EDGSADVFVH YSEIQGNGFR TLEENQRVEF EVGQGTKGPQ        60
     ATGVRAV                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page