(data stored in ACNUC1104 zone)

EMBL: AP008957.PE515

AP008957.PE515       Location/Qualifiers
FT   CDS             570311..570877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05150"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31223"
FT                   /db_xref="GOA:C0ZNH1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH1"
FT                   /protein_id="BAH31223.1"
FT                   /translation="MSDQNWGPGQPSQNPPYGQMPPMPPQGYQPPTPAYPFASWISRVF
FT                   ASILDGFVVPLPGVILAGIGAVIAFSGSEVTTYDDGSVSAEGGNPVGVIVMVVGILAIF
FT                   LIEVWNLVFRQGNTGQTLGKKWLGISVIRESDGVPLGPVMALLRWIMMAILGGACFLNY
FT                   LWPLWDSKHQCWHDMVVRSVVVRAR"
     MSDQNWGPGQ PSQNPPYGQM PPMPPQGYQP PTPAYPFASW ISRVFASILD GFVVPLPGVI        60
     LAGIGAVIAF SGSEVTTYDD GSVSAEGGNP VGVIVMVVGI LAIFLIEVWN LVFRQGNTGQ       120
     TLGKKWLGIS VIRESDGVPL GPVMALLRWI MMAILGGACF LNYLWPLWDS KHQCWHDMVV       180
     RSVVVRAR                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page