(data stored in ACNUC1104 zone)

EMBL: AP008957.PE521

AP008957.PE521       Location/Qualifiers
FT   CDS             complement(581110..581976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05210"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31229"
FT                   /db_xref="GOA:C0ZNH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH7"
FT                   /protein_id="BAH31229.1"
FT                   /translation="MNPHETPLLAVEDLVVEYPVPDGVFRAVDAVSFSVEKGKTLAIVG
FT                   ESGCGKSTIARSIVRLLTPTSGRILVDGNDIAQMSEKSLRPFRSRVQMVFQDPYGSLDP
FT                   HLTAEDIIGEPLRLKGVRSKSERAKAAAELVDRVGLPSSALHRRPAEFSGGQRQRIGIA
FT                   RALASGPEILVCDEATSALDVSVQAQVLALLREIQADTGLTYVFISHNLGVVREISETV
FT                   VVMSKGTIVESGSTDTVLASPHEPYTRALRGAALDPTTMVGIKPRHVVAALSKNLLAKQ
FT                   TESRGVA"
     MNPHETPLLA VEDLVVEYPV PDGVFRAVDA VSFSVEKGKT LAIVGESGCG KSTIARSIVR        60
     LLTPTSGRIL VDGNDIAQMS EKSLRPFRSR VQMVFQDPYG SLDPHLTAED IIGEPLRLKG       120
     VRSKSERAKA AAELVDRVGL PSSALHRRPA EFSGGQRQRI GIARALASGP EILVCDEATS       180
     ALDVSVQAQV LALLREIQAD TGLTYVFISH NLGVVREISE TVVVMSKGTI VESGSTDTVL       240
     ASPHEPYTRA LRGAALDPTT MVGIKPRHVV AALSKNLLAK QTESRGVA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page