(data stored in ACNUC1104 zone)

EMBL: AP008957.PE522

AP008957.PE522       Location/Qualifiers
FT   CDS             complement(581973..582806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05220"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31230"
FT                   /db_xref="GOA:C0ZNH8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH8"
FT                   /protein_id="BAH31230.1"
FT                   /translation="MGNLLRVDDLQIELVTANGVIRAVDGVSFCIDAGEAVTIIGESGS
FT                   GKSTTAMGILGLLPDDLAVLSGKAVFKGQDILGNTKILNDIRGKHIALIPQDPMTALSP
FT                   VHTIGSQLREAVRHSGVTAKKQQIERAVQLLEQVRIPYPDQQLDKYPHQLSGGMLQRVL
FT                   IAGALAAGPELIVADEPTSALDVTVQAGILDLLLELQERTGIGMLVITHDLGVARLVSD
FT                   RIYVMKDGRFVETGNADVLVDSPQSAYTQKLLDAIPHLGPWDGDPARSTQIGASA"
     MGNLLRVDDL QIELVTANGV IRAVDGVSFC IDAGEAVTII GESGSGKSTT AMGILGLLPD        60
     DLAVLSGKAV FKGQDILGNT KILNDIRGKH IALIPQDPMT ALSPVHTIGS QLREAVRHSG       120
     VTAKKQQIER AVQLLEQVRI PYPDQQLDKY PHQLSGGMLQ RVLIAGALAA GPELIVADEP       180
     TSALDVTVQA GILDLLLELQ ERTGIGMLVI THDLGVARLV SDRIYVMKDG RFVETGNADV       240
     LVDSPQSAYT QKLLDAIPHL GPWDGDPARS TQIGASA                                277
//

If you have problems or comments...

PBIL Back to PBIL home page