(data stored in ACNUC1104 zone)

EMBL: AP008957.PE523

AP008957.PE523       Location/Qualifiers
FT   CDS             complement(582810..583757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05230"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31231"
FT                   /db_xref="GOA:C0ZNH9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH9"
FT                   /protein_id="BAH31231.1"
FT                   /translation="MTTVLEPPTTPRASAVTEADFARAGATRRKRDSRVKIWAGSICAL
FT                   LVILPVALAGLLPLADPNQTNLSSRRLPPLTDGHLFGTDQLGRDLLSRILHGGQVSLTI
FT                   GILAVIVSGVIGIVAGSAAGYFGGWVDTVISRLLEAQLSLPLLMMLLLVVALFGPSIPV
FT                   ITFVIAIAQWPEVARLTRSLVLVEREKPYVAAARVLGLTRMAILLRHVIPNIVKQASLV
FT                   VLLLLAQAVLLESSLSYLGAGPQRPFATWGRIIADGQDYITTSWWIVTLTGLMIVLLVV
FT                   GVNLLGDGLRDRPAGSKRLGASLFRRGNAQKAKA"
     MTTVLEPPTT PRASAVTEAD FARAGATRRK RDSRVKIWAG SICALLVILP VALAGLLPLA        60
     DPNQTNLSSR RLPPLTDGHL FGTDQLGRDL LSRILHGGQV SLTIGILAVI VSGVIGIVAG       120
     SAAGYFGGWV DTVISRLLEA QLSLPLLMML LLVVALFGPS IPVITFVIAI AQWPEVARLT       180
     RSLVLVEREK PYVAAARVLG LTRMAILLRH VIPNIVKQAS LVVLLLLAQA VLLESSLSYL       240
     GAGPQRPFAT WGRIIADGQD YITTSWWIVT LTGLMIVLLV VGVNLLGDGL RDRPAGSKRL       300
     GASLFRRGNA QKAKA                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page