(data stored in ACNUC1104 zone)

EMBL: AP008957.PE525

AP008957.PE525       Location/Qualifiers
FT   CDS             complement(584766..586328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05250"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31233"
FT                   /db_xref="GOA:C0ZNI1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI1"
FT                   /protein_id="BAH31233.1"
FT                   /translation="MRTPQLSRRSFLQFTGLIGGATLLGTTAACAGPTGKPTQDTLVLG
FT                   LNRSLVSLDNKLNQFDAAVTAQRGVRQGLTRIGDNLTPQLVLADRFESTGPTEWTVRLR
FT                   EGIRYSDGTPVLIDDVTTAMQMYQQVSGSFVAPQFPEWPTVVPIDDRTFILRTNSPVPV
FT                   LDSLMSNILITPAAANEPNELQSGIGSGPFVVSESNRGTGDYTLVANDNYWGPAPGVRR
FT                   VQVRFIPEEAGRVVALRSGEVDVIDSISPDSAEQLADLPGVQVDTVPSTRINQLFFNFR
FT                   KPADHPLSNPRVREALTYAIDGESLARDVLIGSAVPATGPAPSTLDGAVKTGTYQYDPR
FT                   KARQMLEAEGADDLELTFIWETGEFTNDVSVMESVLEMMKAVGVRVKLQQFEPGGDISS
FT                   WRQGKTGDWDVLGNGYGNQTGLALTTLQGMYAGTAEKEATRDTYHGYVFPEITAKIQAA
FT                   SSEPDPTKRAALLDAAQQDIWNTWPCLWSFVPNALLAKRTRVQNVSLTPINSYDLGAVR
FT                   LEA"
     MRTPQLSRRS FLQFTGLIGG ATLLGTTAAC AGPTGKPTQD TLVLGLNRSL VSLDNKLNQF        60
     DAAVTAQRGV RQGLTRIGDN LTPQLVLADR FESTGPTEWT VRLREGIRYS DGTPVLIDDV       120
     TTAMQMYQQV SGSFVAPQFP EWPTVVPIDD RTFILRTNSP VPVLDSLMSN ILITPAAANE       180
     PNELQSGIGS GPFVVSESNR GTGDYTLVAN DNYWGPAPGV RRVQVRFIPE EAGRVVALRS       240
     GEVDVIDSIS PDSAEQLADL PGVQVDTVPS TRINQLFFNF RKPADHPLSN PRVREALTYA       300
     IDGESLARDV LIGSAVPATG PAPSTLDGAV KTGTYQYDPR KARQMLEAEG ADDLELTFIW       360
     ETGEFTNDVS VMESVLEMMK AVGVRVKLQQ FEPGGDISSW RQGKTGDWDV LGNGYGNQTG       420
     LALTTLQGMY AGTAEKEATR DTYHGYVFPE ITAKIQAASS EPDPTKRAAL LDAAQQDIWN       480
     TWPCLWSFVP NALLAKRTRV QNVSLTPINS YDLGAVRLEA                             520
//

If you have problems or comments...

PBIL Back to PBIL home page