(data stored in ACNUC1104 zone)

EMBL: AP008957.PE526

AP008957.PE526       Location/Qualifiers
FT   CDS             586336..586581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31234"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI2"
FT                   /protein_id="BAH31234.1"
FT                   /translation="MVIGDLSILTGQRGGDAPSGLLVNNRVGLSLVTQLTMALLRTSRK
FT                   SRNFDCVLRASVAMLCILDSDRKGVEEFDETTGNHR"
     MVIGDLSILT GQRGGDAPSG LLVNNRVGLS LVTQLTMALL RTSRKSRNFD CVLRASVAML        60
     CILDSDRKGV EEFDETTGNH R                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page