(data stored in ACNUC1104 zone)

EMBL: AP008957.PE53

AP008957.PE53        Location/Qualifiers
FT   CDS             68663..69559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30761"
FT                   /db_xref="GOA:C0ZLJ3"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ3"
FT                   /protein_id="BAH30761.1"
FT                   /translation="MRARRLVAVLSALAAAVVVPVVSSPVASADPCPGLYVVAIPGTWE
FT                   PSGTSPGAGMLAPVTNGLPGSVRTDYVTYSATAFPWESNVYAKSKQQAVDNARGMIAAM
FT                   AASCGDTRFAIVGYSQGADAAGDLAAEIGTGIGVVPPTRVEGVGLLSDPRRSESDVLIG
FT                   PAVGGNGASGARIGGFGWLSGKTVTLCAVGDLYCSTPKDDFVMRLAGFMAQVSDPTPAN
FT                   ALSLRDEAAVIVNDLVTAGGLPALMAQLDPGANSRRVDQLVAFYGSQVHTDYTRYVVDG
FT                   AGNSATSWLHNWLAGKA"
     MRARRLVAVL SALAAAVVVP VVSSPVASAD PCPGLYVVAI PGTWEPSGTS PGAGMLAPVT        60
     NGLPGSVRTD YVTYSATAFP WESNVYAKSK QQAVDNARGM IAAMAASCGD TRFAIVGYSQ       120
     GADAAGDLAA EIGTGIGVVP PTRVEGVGLL SDPRRSESDV LIGPAVGGNG ASGARIGGFG       180
     WLSGKTVTLC AVGDLYCSTP KDDFVMRLAG FMAQVSDPTP ANALSLRDEA AVIVNDLVTA       240
     GGLPALMAQL DPGANSRRVD QLVAFYGSQV HTDYTRYVVD GAGNSATSWL HNWLAGKA         298
//

If you have problems or comments...

PBIL Back to PBIL home page