(data stored in ACNUC1104 zone)

EMBL: AP008957.PE532

AP008957.PE532       Location/Qualifiers
FT   CDS             599795..600253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31240"
FT                   /db_xref="GOA:C0ZNI8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI8"
FT                   /protein_id="BAH31240.1"
FT                   /translation="MTTTTGQRLDIAKLAPEVYKAMIALDAAARKGLEPTLVELVLTRA
FT                   SQLNHCAWCLDMHTRDARKVGVTEQKLYLLNAWEEARGMYSDRERAALALTEAVTVLTD
FT                   GFVPDEVYSEAAGEFSEEELAQLISVIFTINAWNRIAVTTRKAPPVRD"
     MTTTTGQRLD IAKLAPEVYK AMIALDAAAR KGLEPTLVEL VLTRASQLNH CAWCLDMHTR        60
     DARKVGVTEQ KLYLLNAWEE ARGMYSDRER AALALTEAVT VLTDGFVPDE VYSEAAGEFS       120
     EEELAQLISV IFTINAWNRI AVTTRKAPPV RD                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page