(data stored in ACNUC1104 zone)

EMBL: AP008957.PE539

AP008957.PE539       Location/Qualifiers
FT   CDS             complement(607304..608875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31247"
FT                   /db_xref="GOA:C0ZNJ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ5"
FT                   /protein_id="BAH31247.1"
FT                   /translation="MLPIIIIAVVVAVIIFIVLPAIYVKNYVKVPPNEVAVFTGRGKPK
FT                   VVRGGARFKIPGIERVDIMSLEPFNVSINLKNALSNDGVPVNVEAVGLVRIGSADEAVQ
FT                   TAVQRFLTSDLDELQQQINEILAGSLRGITATMTVEDLNSNRDSLARSVVEEAGGDLAR
FT                   IGMEVDVIKIAGISDFNGYLESLGQRRIAEVKRDAAIGTAEAERDSQIQSAKARQAGSV
FT                   AQAEADTAIASANQKRDVELARLRAQTEAENAEADQAGPLAQATAEKAVGIAREQAEAA
FT                   RVEARTEVERRRAQQSEAALQADVIAPAEAERQASIARAEGERQAAILRAQAQAESARQ
FT                   AGGAQADARKLVADAVRSEQQADADGLRARLEAEADGRKVAADAVRAEQQAEADGLRAK
FT                   LEAEAAGKRQIAEALNSYTPQAAQLLTLPDVLAALVDATAAAAKPVGDIDRISIVGGSD
FT                   GAQGSIGSILGISPQVIAGVIETLESSGVDITGLLNGLNKTASVPVGSVHNSVHNSENG
FT                   SATVDA"
     MLPIIIIAVV VAVIIFIVLP AIYVKNYVKV PPNEVAVFTG RGKPKVVRGG ARFKIPGIER        60
     VDIMSLEPFN VSINLKNALS NDGVPVNVEA VGLVRIGSAD EAVQTAVQRF LTSDLDELQQ       120
     QINEILAGSL RGITATMTVE DLNSNRDSLA RSVVEEAGGD LARIGMEVDV IKIAGISDFN       180
     GYLESLGQRR IAEVKRDAAI GTAEAERDSQ IQSAKARQAG SVAQAEADTA IASANQKRDV       240
     ELARLRAQTE AENAEADQAG PLAQATAEKA VGIAREQAEA ARVEARTEVE RRRAQQSEAA       300
     LQADVIAPAE AERQASIARA EGERQAAILR AQAQAESARQ AGGAQADARK LVADAVRSEQ       360
     QADADGLRAR LEAEADGRKV AADAVRAEQQ AEADGLRAKL EAEAAGKRQI AEALNSYTPQ       420
     AAQLLTLPDV LAALVDATAA AAKPVGDIDR ISIVGGSDGA QGSIGSILGI SPQVIAGVIE       480
     TLESSGVDIT GLLNGLNKTA SVPVGSVHNS VHNSENGSAT VDA                         523
//

If you have problems or comments...

PBIL Back to PBIL home page