(data stored in ACNUC1104 zone)

EMBL: AP008957.PE54

AP008957.PE54        Location/Qualifiers
FT   CDS             complement(69560..69742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30762"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ4"
FT                   /protein_id="BAH30762.1"
FT                   /translation="MDSAEILYADGTCKALADGMPRSEVLAEFNSVGEVYSQITPMSSQ
FT                   RIAEIYVDTAEQTYC"
     MDSAEILYAD GTCKALADGM PRSEVLAEFN SVGEVYSQIT PMSSQRIAEI YVDTAEQTYC        60
//

If you have problems or comments...

PBIL Back to PBIL home page