(data stored in ACNUC1104 zone)

EMBL: AP008957.PE551

AP008957.PE551       Location/Qualifiers
FT   CDS             623010..624119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31259"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK7"
FT                   /protein_id="BAH31259.1"
FT                   /translation="MSWTLRKADLDDLARGAALLGTGGGGDPFVGKMLVTQALGEAGEI
FT                   TILDPEELDDDAWVIPVAQMGAPTVVVEKMPRGTEPELALITLEKHTGRTADATMPMEC
FT                   GGINSMIPLLVAARRGLPVVDADGMGRAFPQLEMETFSVYGISASPLAMANEHDEVAIF
FT                   DTGSDNARLEGLARGVTSRFGGMAHIAQYSMTGADVKRTAIPRTLSLASAIGRSIRLSR
FT                   EQRVDPVQALVDGLADTLYGYGRVLFHGKVIDVDRRTDEGFARGSVRIAGVGDEELEVQ
FT                   FQNENLIAVQSGVMVAIVPDLICIVEADTAEPITTEGLRYGQRVAVIGIATPPIMRTPE
FT                   ALAVFGPASFGLDRPFLPVETLEQPVLAE"
     MSWTLRKADL DDLARGAALL GTGGGGDPFV GKMLVTQALG EAGEITILDP EELDDDAWVI        60
     PVAQMGAPTV VVEKMPRGTE PELALITLEK HTGRTADATM PMECGGINSM IPLLVAARRG       120
     LPVVDADGMG RAFPQLEMET FSVYGISASP LAMANEHDEV AIFDTGSDNA RLEGLARGVT       180
     SRFGGMAHIA QYSMTGADVK RTAIPRTLSL ASAIGRSIRL SREQRVDPVQ ALVDGLADTL       240
     YGYGRVLFHG KVIDVDRRTD EGFARGSVRI AGVGDEELEV QFQNENLIAV QSGVMVAIVP       300
     DLICIVEADT AEPITTEGLR YGQRVAVIGI ATPPIMRTPE ALAVFGPASF GLDRPFLPVE       360
     TLEQPVLAE                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page