(data stored in ACNUC1104 zone)

EMBL: AP008957.PE555

AP008957.PE555       Location/Qualifiers
FT   CDS             628481..629095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31263"
FT                   /db_xref="GOA:C0ZNL1"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL1"
FT                   /protein_id="BAH31263.1"
FT                   /translation="MSSRASHSLHVAVELTGSGHHPAAEGAPGNLPIIGGDYWVDLTEG
FT                   EKALDLASFPTNVVRIRAADLREAQLERARIRAAVAEEGRDPDSVAVLVDLEILIAPEA
FT                   RSARKELAQLDSALTAPRVPVSLHYVGTPSGLGSLIADIRAAEVADGVTLLPLALPRTL
FT                   EHLVDSTIPWLQDRGLVTPSTAVDEVLGRFGLPPRQRTLAS"
     MSSRASHSLH VAVELTGSGH HPAAEGAPGN LPIIGGDYWV DLTEGEKALD LASFPTNVVR        60
     IRAADLREAQ LERARIRAAV AEEGRDPDSV AVLVDLEILI APEARSARKE LAQLDSALTA       120
     PRVPVSLHYV GTPSGLGSLI ADIRAAEVAD GVTLLPLALP RTLEHLVDST IPWLQDRGLV       180
     TPSTAVDEVL GRFGLPPRQR TLAS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page