(data stored in ACNUC1104 zone)

EMBL: AP008957.PE558

AP008957.PE558       Location/Qualifiers
FT   CDS             631087..632298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31266"
FT                   /db_xref="GOA:C0ZNL4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL4"
FT                   /protein_id="BAH31266.1"
FT                   /translation="MADGITVVALGGAGAMGSAAVRLAATLPGIGKVVVADRDIDAAKR
FT                   LSVELAQASAEVEARSIDVTDGRTLRELLDGADVVVNTVGPFFRFGVGILQAAIETGTH
FT                   YLDICDDWEPAVDMLELDCAARGAGICAVVGMGASPGMSNLLAAMAVSRLDVVDDLYTA
FT                   WPVDVEGEDESVDTLSAAAVHWMQQISGTVPVVRAGRIVNEEPLRSIALELPGGRRGNA
FT                   YVVGHPEPVMFHRTINPAGHSANLMVITPETVAFLDVLRSDIDKGRIDLDSAAEELGKP
FT                   SLRRMIRAAPRMLTRAGHGSLPLFFASATGVREGREMRVVARIADDSPVSELLSDMAGA
FT                   TAIPLALGLAQVVSRLADGTIRDRVGVHSAESVIDPDVLFTALARLFGRTDWSDIVTVE
FT                   SEFR"
     MADGITVVAL GGAGAMGSAA VRLAATLPGI GKVVVADRDI DAAKRLSVEL AQASAEVEAR        60
     SIDVTDGRTL RELLDGADVV VNTVGPFFRF GVGILQAAIE TGTHYLDICD DWEPAVDMLE       120
     LDCAARGAGI CAVVGMGASP GMSNLLAAMA VSRLDVVDDL YTAWPVDVEG EDESVDTLSA       180
     AAVHWMQQIS GTVPVVRAGR IVNEEPLRSI ALELPGGRRG NAYVVGHPEP VMFHRTINPA       240
     GHSANLMVIT PETVAFLDVL RSDIDKGRID LDSAAEELGK PSLRRMIRAA PRMLTRAGHG       300
     SLPLFFASAT GVREGREMRV VARIADDSPV SELLSDMAGA TAIPLALGLA QVVSRLADGT       360
     IRDRVGVHSA ESVIDPDVLF TALARLFGRT DWSDIVTVES EFR                         403
//

If you have problems or comments...

PBIL Back to PBIL home page