(data stored in ACNUC1104 zone)

EMBL: AP008957.PE561

AP008957.PE561       Location/Qualifiers
FT   CDS             633177..633755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31269"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL7"
FT                   /protein_id="BAH31269.1"
FT                   /translation="MQVVLDDYVVGASFATDLVNTSPRVWVEAGDALRDPQALHDLLDE
FT                   HGLSPDALRNGRRLTGGELADVQALREEIRSILDAPTSDELVDRTDQLLQTVPHHVRLV
FT                   PDAQFDYRWNALPDRRIDLTGELTLLIGYSLLGTLRTLGYERFRPCASPTCNGVFVDTS
FT                   RGGRRRYCMPALCGNRINVANHRQRQRRT"
     MQVVLDDYVV GASFATDLVN TSPRVWVEAG DALRDPQALH DLLDEHGLSP DALRNGRRLT        60
     GGELADVQAL REEIRSILDA PTSDELVDRT DQLLQTVPHH VRLVPDAQFD YRWNALPDRR       120
     IDLTGELTLL IGYSLLGTLR TLGYERFRPC ASPTCNGVFV DTSRGGRRRY CMPALCGNRI       180
     NVANHRQRQR RT                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page