(data stored in ACNUC1104 zone)

EMBL: AP008957.PE568

AP008957.PE568       Location/Qualifiers
FT   CDS             complement(641099..641626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31276"
FT                   /db_xref="GOA:C0ZNM4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM4"
FT                   /protein_id="BAH31276.1"
FT                   /translation="MSRLASLTPTTAVGASKDLLAELVNRHGQVGDMVAAMAHSPAVLG
FT                   GYLQLSRAMKRAKLSRKITERISIAVQVQQGCAVCLEAHVAAAHANGVEADEIERARAG
FT                   TSADPAIAAMIDLGLRVYREPASISDEHITGLRAHGYGDREIADVVGIVALNVLTGAFN
FT                   LVAGVKPNEPDR"
     MSRLASLTPT TAVGASKDLL AELVNRHGQV GDMVAAMAHS PAVLGGYLQL SRAMKRAKLS        60
     RKITERISIA VQVQQGCAVC LEAHVAAAHA NGVEADEIER ARAGTSADPA IAAMIDLGLR       120
     VYREPASISD EHITGLRAHG YGDREIADVV GIVALNVLTG AFNLVAGVKP NEPDR            175
//

If you have problems or comments...

PBIL Back to PBIL home page