(data stored in ACNUC1104 zone)

EMBL: AP008957.PE57

AP008957.PE57        Location/Qualifiers
FT   CDS             71230..72081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30765"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ7"
FT                   /protein_id="BAH30765.1"
FT                   /translation="MVTECHHRCGVRPVITCASGWAKAALHQEDLRGHEITGESSNMFR
FT                   DSVLAGPVLRRGVTALAVAAAATMFVGTAATAEPAAVVGEVSADSIAAARAQAIGTTVT
FT                   VVGTATTPSGVFESSFYDKGFGLQSGNSGIYISDPNNSGIALGDQVQVTGVLADQEGLL
FT                   VVRPTAVEVIGTTTQISPARLPLNAIGEGSEGRLVTVSGIVSGPVVDDLPYGHKILVSG
FT                   VDGNTVIFVNTQTGIDVDAIAVGRPITVTGFSGQYASTYEVLPRSEADVQQGFTGSLSF
FT                   GS"
     MVTECHHRCG VRPVITCASG WAKAALHQED LRGHEITGES SNMFRDSVLA GPVLRRGVTA        60
     LAVAAAATMF VGTAATAEPA AVVGEVSADS IAAARAQAIG TTVTVVGTAT TPSGVFESSF       120
     YDKGFGLQSG NSGIYISDPN NSGIALGDQV QVTGVLADQE GLLVVRPTAV EVIGTTTQIS       180
     PARLPLNAIG EGSEGRLVTV SGIVSGPVVD DLPYGHKILV SGVDGNTVIF VNTQTGIDVD       240
     AIAVGRPITV TGFSGQYAST YEVLPRSEAD VQQGFTGSLS FGS                         283
//

If you have problems or comments...

PBIL Back to PBIL home page