(data stored in ACNUC1104 zone)

EMBL: AP008957.PE571

AP008957.PE571       Location/Qualifiers
FT   CDS             644387..644764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31279"
FT                   /db_xref="GOA:C0ZNM7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM7"
FT                   /protein_id="BAH31279.1"
FT                   /translation="MSEATEVGSAPSSAPNSAQGSDATGDACCTSDSHGYITAKGDYLA
FT                   RLRRIEGQARGLQRMVDEDKYCIDILTQVSAMTKGLQAVAMGLLEDHIGHCVVKAAVAG
FT                   GPEADAKIKEANDAIARLVRS"
     MSEATEVGSA PSSAPNSAQG SDATGDACCT SDSHGYITAK GDYLARLRRI EGQARGLQRM        60
     VDEDKYCIDI LTQVSAMTKG LQAVAMGLLE DHIGHCVVKA AVAGGPEADA KIKEANDAIA       120
     RLVRS                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page