(data stored in ACNUC1104 zone)

EMBL: AP008957.PE574

AP008957.PE574       Location/Qualifiers
FT   CDS             complement(646983..647420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31282"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN0"
FT                   /protein_id="BAH31282.1"
FT                   /translation="MFRLYCNSAGPYVLCCAHFPEFTGSNSDEEFSVQQSFDRAVEKIL
FT                   RDASFEPTTLTLVGEQQGYPVGDRLFDTTVPRTGTVSYAFQEAGPSWIVLGLDVSADEF
FT                   WSEIDDDADLHGLGPTSPLRSVPATVLTETGWPRRSDLDSP"
     MFRLYCNSAG PYVLCCAHFP EFTGSNSDEE FSVQQSFDRA VEKILRDASF EPTTLTLVGE        60
     QQGYPVGDRL FDTTVPRTGT VSYAFQEAGP SWIVLGLDVS ADEFWSEIDD DADLHGLGPT       120
     SPLRSVPATV LTETGWPRRS DLDSP                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page