(data stored in ACNUC1104 zone)

EMBL: AP008957.PE577

AP008957.PE577       Location/Qualifiers
FT   CDS             649262..649906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05770"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31285"
FT                   /db_xref="GOA:C0ZNN3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN3"
FT                   /protein_id="BAH31285.1"
FT                   /translation="MGSVAKAKEAVEPVGPRIGARLKAARQSKRLTLDDLAEACGVTKG
FT                   YLSKLERDHVNASVATLIKVCAVLEIPVGSLFENASAGEVVRADAMPQISFGGEKMTEY
FT                   LLTPTSERRIQVLLGELEPGGGSGQEFYSLPIDVNFVHVLEGGLRVSFEGGRTDPNGEA
FT                   VDAEDVVLAAGDSFTFTPTHNHSFQAEGSALAKVLWVLNPALPEGPRASPS"
     MGSVAKAKEA VEPVGPRIGA RLKAARQSKR LTLDDLAEAC GVTKGYLSKL ERDHVNASVA        60
     TLIKVCAVLE IPVGSLFENA SAGEVVRADA MPQISFGGEK MTEYLLTPTS ERRIQVLLGE       120
     LEPGGGSGQE FYSLPIDVNF VHVLEGGLRV SFEGGRTDPN GEAVDAEDVV LAAGDSFTFT       180
     PTHNHSFQAE GSALAKVLWV LNPALPEGPR ASPS                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page