(data stored in ACNUC1104 zone)

EMBL: AP008957.PE585

AP008957.PE585       Location/Qualifiers
FT   CDS             complement(661193..661666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31293"
FT                   /db_xref="GOA:C0ZNP1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP1"
FT                   /protein_id="BAH31293.1"
FT                   /translation="MTSLLHPNASHVAETLISRGHHGVIVTQPEATHTAAEAAAAVGVE
FT                   VGAITKSLVFLLDDDPVLLLVSGAHQVNLKATGERLEGKLTRAPLEMAKSATGQPIGGV
FT                   APLGHPTNLPTYIDTALEQYPELWAAAGHPNTVFRTTYSELLRITAGLAVDMD"
     MTSLLHPNAS HVAETLISRG HHGVIVTQPE ATHTAAEAAA AVGVEVGAIT KSLVFLLDDD        60
     PVLLLVSGAH QVNLKATGER LEGKLTRAPL EMAKSATGQP IGGVAPLGHP TNLPTYIDTA       120
     LEQYPELWAA AGHPNTVFRT TYSELLRITA GLAVDMD                                157
//

If you have problems or comments...

PBIL Back to PBIL home page